![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) ![]() |
![]() | Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins) |
![]() | Protein Ribonuclease PH, domain 1 [102758] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [102760] (2 PDB entries) |
![]() | Domain d1r6ma1: 1r6m A:1-151 [97155] Other proteins in same PDB: d1r6ma2 complexed with po4 |
PDB Entry: 1r6m (more details), 2 Å
SCOP Domain Sequences for d1r6ma1:
Sequence, based on SEQRES records: (download)
>d1r6ma1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa} mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkgqgqgwl taeygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdvi qadggtrtasitgatvalidalavlkkrgal
>d1r6ma1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa} mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkqgwltae ygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdviqad ggtrtasitgatvalidalavlkkrgal
Timeline for d1r6ma1: