Lineage for d1r6la2 (1r6l A:152-239)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532281Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2532282Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2532283Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2532401Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. 2532423Species Pseudomonas aeruginosa [TaxId:287] [103152] (2 PDB entries)
  8. 2532424Domain d1r6la2: 1r6l A:152-239 [97154]
    Other proteins in same PDB: d1r6la1
    complexed with nhe, so4

Details for d1r6la2

PDB Entry: 1r6l (more details), 1.9 Å

PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1r6la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]}
kgnplkqmvaavsvgiyqgvpvldldyledsaaetdlnvvmtdaggfievqgtaegapfr
paelnamlelaqqgmqelfelqraalae

SCOPe Domain Coordinates for d1r6la2:

Click to download the PDB-style file with coordinates for d1r6la2.
(The format of our PDB-style files is described here.)

Timeline for d1r6la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6la1