SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1r6la1 (1r6l A:1-151)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157612Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 protein domains)
  6. 2157730Protein Ribonuclease PH, domain 1 [102758] (4 species)
  7. 2157752Species Pseudomonas aeruginosa [TaxId:287] [102760] (2 PDB entries)
  8. 2157753Domain d1r6la1: 1r6l A:1-151 [97153]
    Other proteins in same PDB: d1r6la2
    complexed with nhe, so4

Details for d1r6la1

PDB Entry: 1r6l (more details), 1.9 Å

PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1r6la1:

Sequence, based on SEQRES records: (download)

>d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]}
mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkgqgqgwl
taeygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdvi
qadggtrtasitgatvalidalavlkkrgal

Sequence, based on observed residues (ATOM records): (download)

>d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]}
mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkqgwltae
ygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdviqad
ggtrtasitgatvalidalavlkkrgal

SCOPe Domain Coordinates for d1r6la1:

Click to download the PDB-style file with coordinates for d1r6la1.
(The format of our PDB-style files is described here.)

Timeline for d1r6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6la2