SCOPe 2.04: Domain d1r6ja_: 1r6j A:

Lineage for d1r6ja_ (1r6j A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1r6ja_: 1r6j A: [97151]
   second PDZ domain
   complexed with cl

Details for d1r6ja_

PDB Entry: 1r6j, 0.73 Å

PDB Description: Ultrahigh resolution Crystal Structure of syntenin PDZ2

PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1r6ja_:

Sequence; same for both SEQRES and ATOM records:

>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitimpaf

Timeline for d1r6ja_:

• d1r6ja_ first appeared in SCOP 1.67
  
• d1r6ja_ appears in SCOPe 2.03
  
• d1r6ja_ appears in SCOPe 2.05
  
• d1r6ja_ appears in the current release, SCOPe 2.08, called d1r6ja1