![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (4 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (35 proteins) Pfam 00595 |
![]() | Protein Syntenin 1 [89311] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89312] (6 PDB entries) |
![]() | Domain d1r6ja_: 1r6j A: [97151] second PDZ domain complexed with cl |
PDB Entry: 1r6j (more details), 0.73 Å
SCOP Domain Sequences for d1r6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens)} gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd sqiadilstsgtvvtitimpaf
Timeline for d1r6ja_: