Lineage for d1r6ja_ (1r6j A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373516Protein Syntenin 1 [89311] (1 species)
  7. 373517Species Human (Homo sapiens) [TaxId:9606] [89312] (6 PDB entries)
  8. 373518Domain d1r6ja_: 1r6j A: [97151]
    second PDZ domain
    complexed with cl

Details for d1r6ja_

PDB Entry: 1r6j (more details), 0.73 Å

PDB Description: Ultrahigh resolution Crystal Structure of syntenin PDZ2

SCOP Domain Sequences for d1r6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens)}
gamdprtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkd
sqiadilstsgtvvtitimpaf

SCOP Domain Coordinates for d1r6ja_:

Click to download the PDB-style file with coordinates for d1r6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1r6ja_: