Lineage for d1r6ha1 (1r6h A:4-172)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483042Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2483072Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2483077Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
    Uniprot O75365 1-162 # 99% sequence identity
  8. 2483082Domain d1r6ha1: 1r6h A:4-172 [97150]
    Other proteins in same PDB: d1r6ha2

Details for d1r6ha1

PDB Entry: 1r6h (more details)

PDB Description: solution structure of human prl-3
PDB Compounds: (A:) protein tyrosine phosphatase type IVA, member 3 isoform 1

SCOPe Domain Sequences for d1r6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ha1 c.45.1.1 (A:4-172) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkdphthktr

SCOPe Domain Coordinates for d1r6ha1:

Click to download the PDB-style file with coordinates for d1r6ha1.
(The format of our PDB-style files is described here.)

Timeline for d1r6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6ha2