SCOP 1.71: Domain d1r67a_: 1r67 A:

Lineage for d1r67a_ (1r67 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (11 PDB entries)

8. Domain d1r67a_: 1r67 A: [97147]
   complexed with mg; mutant

Details for d1r67a_

PDB Entry: 1r67, 1.77 Å

PDB Description: y104a mutant of e.coli ipp isomerase

SCOP Domain Sequences for d1r67a_:

Sequence; same for both SEQRES and ATOM records:

>d1r67a_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
lafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgvei
tppesiypdfraratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhgid
atpwafspwmvmqatnrearkrlsaftqlkl

Timeline for d1r67a_:

• d1r67a_ first appeared in SCOP 1.67
  
• d1r67a_ appears in SCOP 1.69
  
• d1r67a_ appears in SCOP 1.73
  
• d1r67a_ appears in the current release, SCOPe 2.08, called d1r67a1