![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
![]() | Protein Isopentenyl diphosphate isomerase [64370] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [64371] (18 PDB entries) Uniprot Q46822 |
![]() | Domain d1r67a1: 1r67 A:33-182 [97147] Other proteins in same PDB: d1r67a2 complexed with mg; mutant |
PDB Entry: 1r67 (more details), 1.77 Å
SCOPe Domain Sequences for d1r67a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r67a1 d.113.1.2 (A:33-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} lafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgvei tppesiypdfraratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhgid atpwafspwmvmqatnrearkrlsaftqlk
Timeline for d1r67a1: