Lineage for d1r65b_ (1r65 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354256Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 354278Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)
  8. 354298Domain d1r65b_: 1r65 B: [97145]
    complexed with fe2, hg

Details for d1r65b_

PDB Entry: 1r65 (more details), 1.95 Å

PDB Description: crystal structure of ferrous soaked ribonucleotide reductase r2 subunit (wildtype) at ph 5 from e. coli

SCOP Domain Sequences for d1r65b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r65b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1r65b_:

Click to download the PDB-style file with coordinates for d1r65b_.
(The format of our PDB-style files is described here.)

Timeline for d1r65b_: