SCOPe 2.08: Domain d1r5zc_: 1r5z C:

Lineage for d1r5zc_ (1r5z C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.40: V-type ATP synthase subunit C [103485] (1 superfamily)
   9 transmembrane helices

4. Superfamily f.40.1: V-type ATP synthase subunit C [103486] (2 families)
   duplication: consists of three similar structural parts
   automatically mapped to Pfam PF01992

5. Family f.40.1.1: V-type ATP synthase subunit C [103487] (2 proteins)

6. Protein V-type ATP synthase subunit C [103488] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103489] (2 PDB entries)

8. Domain d1r5zc_: 1r5z C: [97137]

Details for d1r5zc_

PDB Entry: 1r5z, 1.95 Å

PDB Description: Crystal Structure of Subunit C of V-ATPase

PDB Compounds: (C:) V-type ATP synthase subunit C

SCOPe Domain Sequences for d1r5zc_:

Sequence; same for both SEQRES and ATOM records:

>d1r5zc_ f.40.1.1 (C:) V-type ATP synthase subunit C {Thermus thermophilus [TaxId: 274]}
ddfaylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravl
rtqaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlree
vwrqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakaakg
ldqpalrdylalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyavld
elsgtpfsglsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrlrl
larrayfglpraqveeevvc

Timeline for d1r5zc_:

• d1r5zc_ first appeared in SCOP 1.67
  
• d1r5zc_ appears in SCOPe 2.07