Lineage for d1r5xb_ (1r5x B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404230Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 404282Superfamily c.97.3: JAB1/MPN domain [102712] (1 family) (S)
  5. 404283Family c.97.3.1: JAB1/MPN domain [102713] (1 protein)
    synonym Mov34, PAD-1; Pfam01398
  6. 404284Protein Hypothetical protein AF2198 [102714] (1 species)
  7. 404285Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries)
  8. 404291Domain d1r5xb_: 1r5x B: [97133]
    structural genomics
    complexed with zn

Details for d1r5xb_

PDB Entry: 1r5x (more details), 2.3 Å

PDB Description: JAMM: A Metalloprotease-like Zinc Site in the Proteasome and Signalosome

SCOP Domain Sequences for d1r5xb_:

Sequence, based on SEQRES records: (download)

>d1r5xb_ c.97.3.1 (B:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus}
tlmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlpi
gmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevv
e

Sequence, based on observed residues (ATOM records): (download)

>d1r5xb_ c.97.3.1 (B:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus}
tlmkisrgllktileaaksahpdefiallsgskdvmdeliflpmkvfgtvhshpspscrp
seedlslftrfgkyhiivcypydenswkcynrkgeevelevve

SCOP Domain Coordinates for d1r5xb_:

Click to download the PDB-style file with coordinates for d1r5xb_.
(The format of our PDB-style files is described here.)

Timeline for d1r5xb_: