Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (1 family) |
Family c.97.3.1: JAB1/MPN domain [102713] (1 protein) synonym Mov34, PAD-1; Pfam01398 |
Protein Hypothetical protein AF2198 [102714] (1 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries) |
Domain d1r5xb_: 1r5x B: [97133] structural genomics complexed with zn |
PDB Entry: 1r5x (more details), 2.3 Å
SCOP Domain Sequences for d1r5xb_:
Sequence, based on SEQRES records: (download)
>d1r5xb_ c.97.3.1 (B:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus} tlmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlpi gmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevv e
>d1r5xb_ c.97.3.1 (B:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus} tlmkisrgllktileaaksahpdefiallsgskdvmdeliflpmkvfgtvhshpspscrp seedlslftrfgkyhiivcypydenswkcynrkgeevelevve
Timeline for d1r5xb_: