SCOPe 2.08: Domain d1r5xb1: 1r5x B:1-119

Lineage for d1r5xb1 (1r5x B:1-119)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
   Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)

6. Protein Hypothetical protein AF2198 [102714] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries)

8. Domain d1r5xb1: 1r5x B:1-119 [97133]
   Other proteins in same PDB: d1r5xa2, d1r5xb2
   structural genomics
   complexed with zn
   missing some secondary structures that made up less than one-third of the common domain

Details for d1r5xb1

PDB Entry: 1r5x, 2.3 Å

PDB Description: JAMM: A Metalloprotease-like Zinc Site in the Proteasome and Signalosome

PDB Compounds: (B:) AfJAMM

SCOPe Domain Sequences for d1r5xb1:

Sequence, based on SEQRES records:

>d1r5xb1 c.97.3.1 (B:1-119) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]}
mkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlpigm
kvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevve

Sequence, based on observed residues (ATOM records):

>d1r5xb1 c.97.3.1 (B:1-119) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]}
mkisrgllktileaaksahpdefiallsgskdvmdeliflpmkvfgtvhshpspscrpse
edlslftrfgkyhiivcypydenswkcynrkgeevelevve

Timeline for d1r5xb1:

• d1r5xb1 first appeared in SCOP 1.67, called d1r5xb_
  
• d1r5xb1 appears in SCOPe 2.07