Lineage for d1r5wd2 (1r5w D:31-120)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198665Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 1198685Domain d1r5wd2: 1r5w D:31-120 [97131]
    Other proteins in same PDB: d1r5wa1, d1r5wa2, d1r5wb1, d1r5wc1, d1r5wc2, d1r5wd1

Details for d1r5wd2

PDB Entry: 1r5w (more details), 2.9 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
PDB Compounds: (D:) MHC H2-IE-beta

SCOPe Domain Sequences for d1r5wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5wd2 d.19.1.1 (D:31-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d1r5wd2:

Click to download the PDB-style file with coordinates for d1r5wd2.
(The format of our PDB-style files is described here.)

Timeline for d1r5wd2: