Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1r5wc1: 1r5w C:82-182 [97128] Other proteins in same PDB: d1r5wa2, d1r5wb1, d1r5wb2, d1r5wc2, d1r5wd1, d1r5wd2 mutant |
PDB Entry: 1r5w (more details), 2.9 Å
SCOP Domain Sequences for d1r5wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5wc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
Timeline for d1r5wc1: