Lineage for d1r5wb2 (1r5w B:32-120)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545542Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2545562Domain d1r5wb2: 1r5w B:32-120 [97127]
    Other proteins in same PDB: d1r5wa1, d1r5wa2, d1r5wb1, d1r5wb3, d1r5wc1, d1r5wc2, d1r5wd1, d1r5wd3

Details for d1r5wb2

PDB Entry: 1r5w (more details), 2.9 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
PDB Compounds: (B:) MHC H2-IE-beta

SCOPe Domain Sequences for d1r5wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5wb2 d.19.1.1 (B:32-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
pwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwnsq
pefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d1r5wb2:

Click to download the PDB-style file with coordinates for d1r5wb2.
(The format of our PDB-style files is described here.)

Timeline for d1r5wb2: