Lineage for d1r5wb1 (1r5w B:121-215)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453132Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 453198Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 453217Domain d1r5wb1: 1r5w B:121-215 [97126]
    Other proteins in same PDB: d1r5wa1, d1r5wa2, d1r5wb2, d1r5wc1, d1r5wc2, d1r5wd2

Details for d1r5wb1

PDB Entry: 1r5w (more details), 2.9 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation

SCOP Domain Sequences for d1r5wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5wb1 b.1.1.2 (B:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1r5wb1:

Click to download the PDB-style file with coordinates for d1r5wb1.
(The format of our PDB-style files is described here.)

Timeline for d1r5wb1: