![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins) |
![]() | Protein Pheromone-binding protein asp1 [101192] (1 species) |
![]() | Species Common honeybee (Apis mellifera) [TaxId:7460] [101193] (1 PDB entry) |
![]() | Domain d1r5ra_: 1r5r A: [97104] complexed with nbb |
PDB Entry: 1r5r (more details), 1.6 Å
SCOP Domain Sequences for d1r5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ra_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Common honeybee (Apis mellifera) [TaxId: 7460]} dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Timeline for d1r5ra_: