Lineage for d1r5qa_ (1r5q A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362413Fold a.186: Circadian clock protein KaiA, C-terminal domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 362414Superfamily a.186.1: Circadian clock protein KaiA, C-terminal domain [101215] (1 family) (S)
  5. 362415Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 362416Protein Circadian clock protein KaiA, C-terminal domain [101217] (2 species)
  7. 362417Species Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId:1180] [101219] (1 PDB entry)
    KaiA from Nostoc species lacks the N-terminal CheY-like domain
  8. 362418Domain d1r5qa_: 1r5q A: [97103]

Details for d1r5qa_

PDB Entry: 1r5q (more details), 2 Å

PDB Description: Crystal Structure Analysis of Kai A from PCC7120

SCOP Domain Sequences for d1r5qa_:

Sequence, based on SEQRES records: (download)

>d1r5qa_ a.186.1.1 (A:) Circadian clock protein KaiA, C-terminal domain {Cyanobacterium (Nostoc sp.) pcc 7120}
evdqqillqqlksdyrqillsyfttdkalkekidkfinavfcanipvpeiieihmelide
fskqlrlegrgdetlmdyrltlidilahlceayrgaif

Sequence, based on observed residues (ATOM records): (download)

>d1r5qa_ a.186.1.1 (A:) Circadian clock protein KaiA, C-terminal domain {Cyanobacterium (Nostoc sp.) pcc 7120}
evdqqillqqlksdyrqillsyfttdlkekidkfinavfcanipvpeiieihmelidefs
kqlrlgdlmdyrltlidilahlceayrgaif

SCOP Domain Coordinates for d1r5qa_:

Click to download the PDB-style file with coordinates for d1r5qa_.
(The format of our PDB-style files is described here.)

Timeline for d1r5qa_: