Lineage for d1r5pb_ (1r5p B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486747Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 2486752Protein Circadian oscillation regulator KaiB [102450] (2 species)
    the differently folded C-terminal half facilitates oligomerization
  7. 2486753Species Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId:1180] [102451] (1 PDB entry)
  8. 2486755Domain d1r5pb_: 1r5p B: [97102]

Details for d1r5pb_

PDB Entry: 1r5p (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of KaiB from PCC7120
PDB Compounds: (B:) circadian oscillation regulator

SCOPe Domain Sequences for d1r5pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5pb_ c.47.1.15 (B:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]}
ktyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptl
skilpppvrkiigdlsdrervligldllyeelt

SCOPe Domain Coordinates for d1r5pb_:

Click to download the PDB-style file with coordinates for d1r5pb_.
(The format of our PDB-style files is described here.)

Timeline for d1r5pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r5pa_