SCOPe 2.08: Domain d1r5pb_: 1r5p B:

Lineage for d1r5pb_ (1r5p B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein Circadian oscillation regulator KaiB [102450] (2 species)
   the differently folded C-terminal half facilitates oligomerization

7. Species Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId:1180] [102451] (1 PDB entry)

8. Domain d1r5pb_: 1r5p B: [97102]

Details for d1r5pb_

PDB Entry: 1r5p, 2.2 Å

PDB Description: Crystal Structure Analysis of KaiB from PCC7120

PDB Compounds: (B:) circadian oscillation regulator

SCOPe Domain Sequences for d1r5pb_:

Sequence; same for both SEQRES and ATOM records:

>d1r5pb_ c.47.1.15 (B:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]}
ktyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptl
skilpppvrkiigdlsdrervligldllyeelt

Timeline for d1r5pb_:

• d1r5pb_ first appeared in SCOP 1.67
  
• d1r5pb_ appears in SCOPe 2.07