Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.15: KaiB-like [102449] (3 proteins) Pfam PF07689; contains members with alternative folds |
Protein Circadian oscillation regulator KaiB [102450] (2 species) the differently folded C-terminal half facilitates oligomerization |
Species Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId:1180] [102451] (1 PDB entry) |
Domain d1r5pa_: 1r5p A: [97101] |
PDB Entry: 1r5p (more details), 2.2 Å
SCOPe Domain Sequences for d1r5pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5pa_ c.47.1.15 (A:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]} tyvlklyvagntpnsvralktlknileqefqgiyalkvidvlknpqlaeedkilatptls kilpppvrkiigdlsdrervligldllyee
Timeline for d1r5pa_: