Lineage for d1r5la2 (1r5l A:91-275)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824333Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 824334Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) (S)
  5. 824335Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
    Pfam PF00650
  6. 824336Protein Alpha-tocopherol transfer protein [102203] (1 species)
  7. 824337Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries)
  8. 824338Domain d1r5la2: 1r5l A:91-275 [97100]
    Other proteins in same PDB: d1r5la1
    complexed with viv

Details for d1r5la2

PDB Entry: 1r5l (more details), 1.5 Å

PDB Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand
PDB Compounds: (A:) PROTEIN (Alpha-tocopherol transfer protein)

SCOP Domain Sequences for d1r5la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5la2 c.13.1.1 (A:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]}
siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq
rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl
ssise

SCOP Domain Coordinates for d1r5la2:

Click to download the PDB-style file with coordinates for d1r5la2.
(The format of our PDB-style files is described here.)

Timeline for d1r5la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r5la1