Lineage for d1r5jb_ (1r5j B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1005388Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1005389Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1005588Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 1005592Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 1005615Species Streptococcus pyogenes [TaxId:1314] [102665] (1 PDB entry)
  8. 1005617Domain d1r5jb_: 1r5j B: [97098]
    structural genomics

Details for d1r5jb_

PDB Entry: 1r5j (more details), 2.7 Å

PDB Description: Crystal Structure of a Phosphotransacetylase from Streptococcus pyogenes
PDB Compounds: (B:) putative phosphotransacetylase

SCOPe Domain Sequences for d1r5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5jb_ c.77.1.5 (B:) Phosphotransacetylase Pta {Streptococcus pyogenes [TaxId: 1314]}
msirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqseevrnllt
klgfadqdytiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvmlvkmgla
dgmvsgaihstadtvrpalqiiktkpgisrtsgvflmnrentseryvfadcainidptaq
elaeiavntaetakifdidpkiamlsfstkgsgkapqvdkvreateiatglnpdlaldge
lqfdaafvpetaaikapdsavagqantfvfpdlqsgnigykiaqrlgmfdaigpilqgln
kpvndlsrgssaediyklaiitaaqaies

SCOPe Domain Coordinates for d1r5jb_:

Click to download the PDB-style file with coordinates for d1r5jb_.
(The format of our PDB-style files is described here.)

Timeline for d1r5jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r5ja_