SCOPe 2.03: Domain d1r5if1: 1r5i F:93-190

Lineage for d1r5if1 (1r5i F:93-190)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1r5if1: 1r5i F:93-190 [97094]
   Other proteins in same PDB: d1r5ia1, d1r5ia2, d1r5ib2, d1r5id_, d1r5ie1, d1r5ie2, d1r5if2, d1r5ih_
   complexed with po4

Details for d1r5if1

PDB Entry: 1r5i, 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex

PDB Compounds: (F:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1r5if1:

Sequence; same for both SEQRES and ATOM records:

>d1r5if1 b.1.1.2 (F:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1r5if1:

• d1r5if1 first appeared in SCOP 1.67
  
• d1r5if1 appears in SCOPe 2.02
  
• d1r5if1 appears in SCOPe 2.04
  
• d1r5if1 appears in the current release, SCOPe 2.08