Lineage for d1r5ie1 (1r5i E:82-181)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453045Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 453053Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 453081Domain d1r5ie1: 1r5i E:82-181 [97092]
    Other proteins in same PDB: d1r5ia2, d1r5ib1, d1r5ib2, d1r5id_, d1r5ie2, d1r5if1, d1r5if2, d1r5ih_

Details for d1r5ie1

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex

SCOP Domain Sequences for d1r5ie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ie1 b.1.1.2 (E:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1r5ie1:

Click to download the PDB-style file with coordinates for d1r5ie1.
(The format of our PDB-style files is described here.)

Timeline for d1r5ie1: