Lineage for d1r5ib2 (1r5i B:1-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545441Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2545455Domain d1r5ib2: 1r5i B:1-92 [97090]
    Other proteins in same PDB: d1r5ia1, d1r5ia2, d1r5ib1, d1r5id1, d1r5id2, d1r5ie1, d1r5ie2, d1r5if1, d1r5ih1, d1r5ih2
    complexed with po4

Details for d1r5ib2

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1r5ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ib2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1r5ib2:

Click to download the PDB-style file with coordinates for d1r5ib2.
(The format of our PDB-style files is described here.)

Timeline for d1r5ib2: