Lineage for d1r5ib2 (1r5i B:1-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409689Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 409701Domain d1r5ib2: 1r5i B:1-92 [97090]
    Other proteins in same PDB: d1r5ia1, d1r5ia2, d1r5ib1, d1r5id_, d1r5ie1, d1r5ie2, d1r5if1, d1r5ih_

Details for d1r5ib2

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex

SCOP Domain Sequences for d1r5ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ib2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1r5ib2:

Click to download the PDB-style file with coordinates for d1r5ib2.
(The format of our PDB-style files is described here.)

Timeline for d1r5ib2: