Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries) probably orthologous to the mouse I-E group |
Domain d1r5ia1: 1r5i A:82-181 [97087] Other proteins in same PDB: d1r5ia2, d1r5ib1, d1r5ib2, d1r5id_, d1r5ie2, d1r5if1, d1r5if2, d1r5ih_ |
PDB Entry: 1r5i (more details), 2.6 Å
SCOP Domain Sequences for d1r5ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ia1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1r5ia1: