SCOP 1.71: Domain d1r56h1: 1r56 H:1-136

Lineage for d1r56h1 (1r56 H:1-136)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.96: T-fold [55619] (1 superfamily)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)

6. Protein Urate oxidase (uricase) [55634] (2 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (4 PDB entries)

8. Domain d1r56h1: 1r56 H:1-136 [97078]

Details for d1r56h1

PDB Entry: 1r56, 2.3 Å

PDB Description: uncomplexed urate oxidase from aspergillus flavus

SCOP Domain Sequences for d1r56h1:

Sequence; same for both SEQRES and ATOM records:

>d1r56h1 d.96.1.4 (H:1-136) Urate oxidase (uricase) {Aspergillus flavus}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

Timeline for d1r56h1:

• d1r56h1 first appeared in SCOP 1.67
  
• d1r56h1 appears in SCOP 1.69
  
• d1r56h1 appears in SCOP 1.73
  
• d1r56h1 appears in the current release, SCOPe 2.08