Lineage for d1r56b2 (1r56 B:137-295)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207550Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2207551Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 2207585Species Aspergillus flavus [TaxId:5059] [55635] (62 PDB entries)
  8. 2207697Domain d1r56b2: 1r56 B:137-295 [97067]
    complexed with peg

Details for d1r56b2

PDB Entry: 1r56 (more details), 2.3 Å

PDB Description: uncomplexed urate oxidase from aspergillus flavus
PDB Compounds: (B:) Uricase

SCOPe Domain Sequences for d1r56b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r56b2 d.96.1.4 (B:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

SCOPe Domain Coordinates for d1r56b2:

Click to download the PDB-style file with coordinates for d1r56b2.
(The format of our PDB-style files is described here.)

Timeline for d1r56b2: