Lineage for d1r4xa2 (1r4x A:763-873)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921132Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 1921133Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 1921155Family d.105.1.2: Coatomer appendage domain [103159] (1 protein)
  6. 1921156Protein Coatomer gamma subunit, C-terminal subdomain [103160] (2 species)
  7. 1921159Species Human (Homo sapiens) [TaxId:9606] [103161] (1 PDB entry)
  8. 1921160Domain d1r4xa2: 1r4x A:763-873 [97055]
    Other proteins in same PDB: d1r4xa1
    complexed with mg

Details for d1r4xa2

PDB Entry: 1r4x (more details), 1.9 Å

PDB Description: Crystal Structure Analys of the Gamma-COPI Appendage domain
PDB Compounds: (A:) Coatomer gamma subunit

SCOPe Domain Sequences for d1r4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4xa2 d.105.1.2 (A:763-873) Coatomer gamma subunit, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
hiqkvmklnfeaawdevgdefekeetftlstiktleeavgnivkflgmhpcersdkvpdn
knthtlllagvfrgghdilvrsrlllldtvtmqvtarsleelpvdiilasv

SCOPe Domain Coordinates for d1r4xa2:

Click to download the PDB-style file with coordinates for d1r4xa2.
(The format of our PDB-style files is described here.)

Timeline for d1r4xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r4xa1