Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.3: Coatomer appendage domain [101536] (1 protein) |
Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101538] (1 PDB entry) |
Domain d1r4xa1: 1r4x A:600-762 [97054] Other proteins in same PDB: d1r4xa2 complexed with mg |
PDB Entry: 1r4x (more details), 1.9 Å
SCOPe Domain Sequences for d1r4xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4xa1 b.1.10.3 (A:600-762) Coatomer gamma subunit C-terminal domain, first subdomain {Human (Homo sapiens) [TaxId: 9606]} mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta vactfscmmkftvkdcdpttgetddegyedeyvledlevtvad
Timeline for d1r4xa1: