Lineage for d1r4xa1 (1r4x A:600-762)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367538Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 367572Family b.1.10.3: Coatomer appendage domain [101536] (1 protein)
  6. 367573Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species)
  7. 367576Species Human (Homo sapiens) [TaxId:9606] [101538] (1 PDB entry)
  8. 367577Domain d1r4xa1: 1r4x A:600-762 [97054]
    Other proteins in same PDB: d1r4xa2
    complexed with cas, mg

Details for d1r4xa1

PDB Entry: 1r4x (more details), 1.9 Å

PDB Description: Crystal Structure Analys of the Gamma-COPI Appendage domain

SCOP Domain Sequences for d1r4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4xa1 b.1.10.3 (A:600-762) Coatomer gamma subunit C-terminal domain, first subdomain {Human (Homo sapiens)}
mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
vactfscmmkftvkdcdpttgetddegyedeyvledlevtvad

SCOP Domain Coordinates for d1r4xa1:

Click to download the PDB-style file with coordinates for d1r4xa1.
(The format of our PDB-style files is described here.)

Timeline for d1r4xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r4xa2