Lineage for d1r4xa1 (1r4x A:600-762)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) 
contains an additional N-terminal strand
Family b.1.10.3: Coatomer appendage domain [101536] (1 protein) Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species) Species Human (Homo sapiens) [TaxId:9606] [101538] (1 PDB entry) 
Domain d1r4xa1: 1r4x A:600-762 [97054]
Other proteins in same PDB: d1r4xa2
complexed with cas, mg
Details for d1r4xa1
PDB Entry: 1r4x (more details), 1.9 Å
PDB Description: Crystal Structure Analys of the Gamma-COPI Appendage domain
SCOP Domain Sequences for d1r4xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4xa1 b.1.10.3 (A:600-762) Coatomer gamma subunit C-terminal domain, first subdomain {Human (Homo sapiens)}
mhhhhhhmtrqeifqeqlaavpefrglgplfksspepvalteseteyvirctkhtftnhm
vfqfdctntlndqtlenvtvqmepteayevlcyvparslpynqpgtcytlvalpkedpta
vactfscmmkftvkdcdpttgetddegyedeyvledlevtvad
SCOP Domain Coordinates for d1r4xa1:
Click to download the PDB-style file with coordinates for d1r4xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r4xa1:
- d1r4xa1 is new in SCOP 1.67
- d1r4xa1 appears in SCOP 1.69
- d1r4xa1 appears in the current release, SCOPe 2.08
View in 3D
