Lineage for d1r4wc_ (1r4w C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 396590Family c.47.1.13: DsbA-like [100953] (2 proteins)
    contains an all-alpha subdomain insertion
  6. 396619Protein Mitochondrial class kappa glutathione S-transferase [102437] (1 species)
    contains larger and less compact insertion in the common fold than DsbA
  7. 396620Species Rat (Rattus norvegicus) [TaxId:10116] [102438] (1 PDB entry)
  8. 396623Domain d1r4wc_: 1r4w C: [97052]

Details for d1r4wc_

PDB Entry: 1r4w (more details), 2.5 Å

PDB Description: Crystal structure of Mitochondrial class kappa glutathione transferase

SCOP Domain Sequences for d1r4wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4wc_ c.47.1.13 (C:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus)}
gpaprvlelfydvlspyswlgfevlcryqhlwniklklrpallagimkdsgnqppamvph
kgqyilkeipllkqlfqvpmsvpkdffgehvkkgtvnamrfltavsmeqpemlekvsrel
wmriwsrdeditesqnilsaaekagmataqaqhllnkistelvksklrettgaackygaf
glpttvahvdgktymlfgsdrmellayllgekwmgpvpptl

SCOP Domain Coordinates for d1r4wc_:

Click to download the PDB-style file with coordinates for d1r4wc_.
(The format of our PDB-style files is described here.)

Timeline for d1r4wc_: