Lineage for d1r4ua1 (1r4u A:1-136)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416305Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 416306Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 416483Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 416484Protein Urate oxidase (uricase) [55634] (1 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 416485Species Aspergillus flavus [TaxId:5059] [55635] (4 PDB entries)
  8. 416488Domain d1r4ua1: 1r4u A:1-136 [97047]

Details for d1r4ua1

PDB Entry: 1r4u (more details), 1.65 Å

PDB Description: urate oxidase from aspergillus flavus complexed with its inhibitor oxonic acid

SCOP Domain Sequences for d1r4ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ua1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

SCOP Domain Coordinates for d1r4ua1:

Click to download the PDB-style file with coordinates for d1r4ua1.
(The format of our PDB-style files is described here.)

Timeline for d1r4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r4ua2