Lineage for d1r4qg_ (1r4q G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667664Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 667767Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 667778Domain d1r4qg_: 1r4q G: [97037]
    Other proteins in same PDB: d1r4qa_, d1r4ql_

Details for d1r4qg_

PDB Entry: 1r4q (more details), 2.5 Å

PDB Description: shiga toxin
PDB Compounds: (G:) Shigella toxin chain B

SCOP Domain Sequences for d1r4qg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4qg_ b.40.2.1 (G:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1r4qg_:

Click to download the PDB-style file with coordinates for d1r4qg_.
(The format of our PDB-style files is described here.)

Timeline for d1r4qg_: