Lineage for d1r4pd_ (1r4p D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559070Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 559367Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 559486Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (1 PDB entry)
  8. 559489Domain d1r4pd_: 1r4p D: [97028]
    Other proteins in same PDB: d1r4pa_

Details for d1r4pd_

PDB Entry: 1r4p (more details), 1.77 Å

PDB Description: shiga toxin type 2

SCOP Domain Sequences for d1r4pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4pd_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOP Domain Coordinates for d1r4pd_:

Click to download the PDB-style file with coordinates for d1r4pd_.
(The format of our PDB-style files is described here.)

Timeline for d1r4pd_: