Lineage for d1r4pa_ (1r4p A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513915Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 513916Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 514029Family d.165.1.2: Shiga toxin, A-chain [56395] (1 protein)
  6. 514030Protein Shiga toxin, A-chain [56396] (2 species)
  7. 514036Species Shigella dysenteriae, toxin II [TaxId:622] [103337] (1 PDB entry)
  8. 514037Domain d1r4pa_: 1r4p A: [97025]
    Other proteins in same PDB: d1r4pb_, d1r4pc_, d1r4pd_, d1r4pe_, d1r4pf_

Details for d1r4pa_

PDB Entry: 1r4p (more details), 1.77 Å

PDB Description: shiga toxin type 2

SCOP Domain Sequences for d1r4pa_:

Sequence, based on SEQRES records: (download)

>d1r4pa_ d.165.1.2 (A:) Shiga toxin, A-chain {Shigella dysenteriae, toxin II}
reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
chhqgarsvravneesqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk

Sequence, based on observed residues (ATOM records): (download)

>d1r4pa_ d.165.1.2 (A:) Shiga toxin, A-chain {Shigella dysenteriae, toxin II}
reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
checqitgdrpvikinntlwesntaaaflnrksqflyttgk

SCOP Domain Coordinates for d1r4pa_:

Click to download the PDB-style file with coordinates for d1r4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1r4pa_: