SCOP 1.69: Domain d1r4oa_: 1r4o A:

Lineage for d1r4oa_ (1r4o A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families)

5. Family g.39.1.2: Nuclear receptor [57721] (12 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (7 PDB entries)

8. Domain d1r4oa_: 1r4o A: [97023]

Details for d1r4oa_

PDB Entry: 1r4o, 2.5 Å

PDB Description: Crystallographic analysis of the interaction of the glucocorticoid receptor with DNA

SCOP Domain Sequences for d1r4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1r4oa_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
acryrkclqagmnlearktk

Timeline for d1r4oa_:

• d1r4oa_ first appeared in SCOP 1.67
  
• d1r4oa_ appears in SCOP 1.71
  
• d1r4oa_ appears in the current release, SCOPe 2.08, called d1r4oa1