Lineage for d1r4nl_ (1r4n L:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499509Protein Nedd8 [54244] (1 species)
  7. 499510Species Human (Homo sapiens) [TaxId:9606] [54245] (3 PDB entries)
  8. 499522Domain d1r4nl_: 1r4n L: [97022]
    Other proteins in same PDB: d1r4na_, d1r4nb_, d1r4nc_, d1r4nd_, d1r4ne_, d1r4nf_, d1r4ng_, d1r4nh_
    complexed with APPBP1 and UBA3

Details for d1r4nl_

PDB Entry: 1r4n (more details), 3.6 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex with atp

SCOP Domain Sequences for d1r4nl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4nl_ d.15.1.1 (L:) Nedd8 {Human (Homo sapiens)}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOP Domain Coordinates for d1r4nl_:

Click to download the PDB-style file with coordinates for d1r4nl_.
(The format of our PDB-style files is described here.)

Timeline for d1r4nl_: