![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Nedd8 [54244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54245] (10 PDB entries) Uniprot Q15843 |
![]() | Domain d1r4nk_: 1r4n K: [97021] Other proteins in same PDB: d1r4na_, d1r4nb_, d1r4nc_, d1r4nd_, d1r4ne_, d1r4nf_, d1r4ng_, d1r4nh_ complexed with APPBP1 and UBA3 complexed with atp, zn |
PDB Entry: 1r4n (more details), 3.6 Å
SCOPe Domain Sequences for d1r4nk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4nk_ d.15.1.1 (K:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d1r4nk_: