| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Nedd8 [54244] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54245] (15 PDB entries) Uniprot Q15843 |
| Domain d1r4ml_: 1r4m L: [97010] Other proteins in same PDB: d1r4ma_, d1r4mb_, d1r4mc_, d1r4md_, d1r4me_, d1r4mf_, d1r4mg_, d1r4mh_ complexed with APPBP1 and UBA3 complexed with zn |
PDB Entry: 1r4m (more details), 3 Å
SCOPe Domain Sequences for d1r4ml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ml_ d.15.1.1 (L:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg
Timeline for d1r4ml_: