Lineage for d1r4mk_ (1r4m K:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194731Protein Nedd8 [54244] (1 species)
  7. 1194732Species Human (Homo sapiens) [TaxId:9606] [54245] (7 PDB entries)
    Uniprot Q15843
  8. 1194750Domain d1r4mk_: 1r4m K: [97009]
    Other proteins in same PDB: d1r4ma_, d1r4mb_, d1r4mc_, d1r4md_, d1r4me_, d1r4mf_, d1r4mg_, d1r4mh_
    complexed with APPBP1 and UBA3
    complexed with zn

Details for d1r4mk_

PDB Entry: 1r4m (more details), 3 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
PDB Compounds: (K:) Ubiquitin-like protein NEDD8

SCOPe Domain Sequences for d1r4mk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4mk_ d.15.1.1 (K:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d1r4mk_:

Click to download the PDB-style file with coordinates for d1r4mk_.
(The format of our PDB-style files is described here.)

Timeline for d1r4mk_: