Lineage for d1r4mi_ (1r4m I:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407836Family d.15.1.1: Ubiquitin-related [54237] (14 proteins)
  6. 407848Protein Nedd8 [54244] (1 species)
  7. 407849Species Human (Homo sapiens) [TaxId:9606] [54245] (3 PDB entries)
  8. 407854Domain d1r4mi_: 1r4m I: [97007]
    Other proteins in same PDB: d1r4ma_, d1r4mb_, d1r4mc_, d1r4md_, d1r4me_, d1r4mf_, d1r4mg_, d1r4mh_

Details for d1r4mi_

PDB Entry: 1r4m (more details), 3 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex

SCOP Domain Sequences for d1r4mi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4mi_ d.15.1.1 (I:) Nedd8 {Human (Homo sapiens)}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOP Domain Coordinates for d1r4mi_:

Click to download the PDB-style file with coordinates for d1r4mi_.
(The format of our PDB-style files is described here.)

Timeline for d1r4mi_: