Lineage for d1r4mh_ (1r4m H:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496069Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 496070Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 496077Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 496092Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 496093Species Human (Homo sapiens) [TaxId:9606] [89765] (4 PDB entries)
  8. 496101Domain d1r4mh_: 1r4m H: [97006]
    Other proteins in same PDB: d1r4ma_, d1r4mc_, d1r4me_, d1r4mg_, d1r4mi_, d1r4mj_, d1r4mk_, d1r4ml_

Details for d1r4mh_

PDB Entry: 1r4m (more details), 3 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex

SCOP Domain Sequences for d1r4mh_:

Sequence, based on SEQRES records: (download)

>d1r4mh_ c.111.1.2 (H:) UBA3 {Human (Homo sapiens)}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft

Sequence, based on observed residues (ATOM records): (download)

>d1r4mh_ c.111.1.2 (H:) UBA3 {Human (Homo sapiens)}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft

SCOP Domain Coordinates for d1r4mh_:

Click to download the PDB-style file with coordinates for d1r4mh_.
(The format of our PDB-style files is described here.)

Timeline for d1r4mh_: