Lineage for d1r4mh_ (1r4m H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149982Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2149983Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2149990Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 protein domains)
    the common fold is elaborated with additional (sub)domains
  6. 2150022Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 2150023Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 2150044Domain d1r4mh_: 1r4m H: [97006]
    Other proteins in same PDB: d1r4ma_, d1r4mc_, d1r4me_, d1r4mg_, d1r4mi_, d1r4mj_, d1r4mk_, d1r4ml_
    complexed with zn

Details for d1r4mh_

PDB Entry: 1r4m (more details), 3 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
PDB Compounds: (H:) ubiquitin-activating enzyme E1C

SCOPe Domain Sequences for d1r4mh_:

Sequence, based on SEQRES records: (download)

>d1r4mh_ c.111.1.2 (H:) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft

Sequence, based on observed residues (ATOM records): (download)

>d1r4mh_ c.111.1.2 (H:) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmatiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatnrtlylqsvtsieertrkelglvdgqeavadvttpqtvlfklhft

SCOPe Domain Coordinates for d1r4mh_:

Click to download the PDB-style file with coordinates for d1r4mh_.
(The format of our PDB-style files is described here.)

Timeline for d1r4mh_: