![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (4 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein Angiotensin converting enzyme 2, ACE2 [103125] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103126] (2 PDB entries) |
![]() | Domain d1r4la_: 1r4l A: [96998] complexed with collectrin homology domain (disordered segments), chains B, C, D and E complexed with cl, nag, xx5, zn |
PDB Entry: 1r4l (more details), 3 Å
SCOP Domain Sequences for d1r4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4la_ d.92.1.5 (A:) Angiotensin converting enzyme 2, ACE2 {Human (Homo sapiens)} stieeqaktfldkfnheaedlfyqsslaswnyntniteenvqnmnnagdkwsaflkeqst laqmyplqeiqnltvklqlqalqqngssvlsedkskrlntilntmstiystgkvcnpdnp qeclllepglneimansldynerlwaweswrsevgkqlrplyeeyvvlknemaranhyed ygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyisp igclpahllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsv glpnmtqgfwensmltdpgnvqkavchptawdlgkgdfrilmctkvtmddfltahhemgh iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspdfqedneteinf llkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetyc dpaslfhvsndysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnml rlgksepwtlalenvvgaknmnvrpllnyfeplftwlkdqnknsfvgwstdwspyad
Timeline for d1r4la_: