Lineage for d1r4ka_ (1r4k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394857Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2394858Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 2394859Protein Argonaute 1 [101694] (1 species)
  7. 2394860Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101695] (1 PDB entry)
  8. 2394861Domain d1r4ka_: 1r4k A: [96997]

Details for d1r4ka_

PDB Entry: 1r4k (more details)

PDB Description: solution structure of the drosophila argonaute 1 paz domain
PDB Compounds: (A:) Argonaute 1

SCOPe Domain Sequences for d1r4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ka_ b.34.14.1 (A:) Argonaute 1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tafykaqpvidfmcevldirdineqrkpltdsqrvkftkeikglkieithcgqmrrkyrv
cnvtrrpaqmqsfplqlengqtvectvakyfldkyrmklryphlpclqvgqehkhtylpl
evcnivagqrcikkltdmqtstmikatarsapdrereinnlvkradfn

SCOPe Domain Coordinates for d1r4ka_:

Click to download the PDB-style file with coordinates for d1r4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ka_: