Lineage for d1r4ga_ (1r4g A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352714Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (6 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 352789Superfamily a.8.5: Phosphoprotein XD domain [101089] (1 family) (S)
  5. 352790Family a.8.5.1: Phosphoprotein XD domain [101090] (1 protein)
  6. 352791Protein RNA polymerase alpha subunit [101091] (2 species)
  7. 352794Species Sendai virus [TaxId:11191] [101093] (1 PDB entry)
  8. 352795Domain d1r4ga_: 1r4g A: [96996]

Details for d1r4ga_

PDB Entry: 1r4g (more details)

PDB Description: solution structure of the sendai virus protein x c-subdomain

SCOP Domain Sequences for d1r4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ga_ a.8.5.1 (A:) RNA polymerase alpha subunit {Sendai virus}
kptmhslrlviessplsraekaayvkslskcktdqevkavmelveediesltn

SCOP Domain Coordinates for d1r4ga_:

Click to download the PDB-style file with coordinates for d1r4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ga_: